Structure of PDB 6nsm Chain B Binding Site BS02

Receptor Information

>6nsm Chain B (length=192) Species: 208963 (Pseudomonas aeruginosa UCBPP-PA14) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GRPRAFDRDTALQRAMDVFWVRGYEGASLAALTEAMEIRPPSLYAAFGSK
EGLFREALAHYLGQHGRYRRDVLDGAPSAREGVAELLRETVARFTSDEFP
RGSLVVLAALTGTPESEAVRDALSAERGESIRLFRERMRRGIADGDLAAD
TDMEELATFYATVLFGLSVQAKDRVPRERLLAVVERALRAWP

Ligand information

>6nsm Chain D (length=26) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaatttatagtgatcgatacaaataa

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6nsm Structures of TetR family transcriptional regulator CifR_C99T-C181R Cysteines mutant complexed with 26bp double-strand operator DNA
Resolution	2.8 Å
Binding residue (original residue number in PDB)	G5 R6 R8 A9 F10 R43 P45 S46
Binding residue (residue number reindexed from 1)	G1 R2 R4 A5 F6 R39 P41 S42

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0001217	DNA-binding transcription repressor activity
GO:0003677	DNA binding

	Biological Process
GO:0009889	regulation of biosynthetic process
GO:0045892	negative regulation of DNA-templated transcription
GO:0080090	regulation of primary metabolic process

	Cellular Component
GO:0032993	protein-DNA complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6nsm, PDBe:6nsm, PDBj:6nsm
PDBsum	6nsm
PubMed
UniProt	Q9HZR6

[Back to BioLiP]