Structure of PDB 6n7r Chain B Binding Site BS02

Receptor Information
>6n7r Chain B (length=195) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RYYCEYCHSYLTHDTLSVRKSHLVGKNHLRITADYYRNKARDIINKHNHK
RRHIGKRGRKERENSSQNETLKVTCLSNKEKRHIMHVKKMNQKELAQTSI
DTLKLLYDGSPGYSKVFVDANRFDIGDLVKASKLPQRANEKSAHHSFKQT
SRSRDETCESNPFPRLNNPKKLEPPKILSQWSNTIPKTSIFYSVD
Ligand information
>6n7r Chain r (length=63) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugguauguucaaaaaaaaaaaaaaaaaaaaaaaaaauuuuuuuuuuuuuu
uuuuuuuuuuuuu
..........<<<<<<<<<<<<<<<<<<<.<<<<<<.>>>>>>>>>>>>>
>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6n7r A unified mechanism for intron and exon definition and back-splicing.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		L13 T14 H24 G27 K28 R139
Binding residue
(residue number reindexed from 1)		L11 T12 H22 G25 K26 R137
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0008270 zinc ion binding
GO:0030619 U1 snRNA binding
GO:0030627 pre-mRNA 5'-splice site binding
GO:0046872 metal ion binding
Biological Process
GO:0000387 spliceosomal snRNP assembly
GO:0000395 mRNA 5'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
Cellular Component
GO:0000243 commitment complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005685 U1 snRNP
GO:0071004 U2-type prespliceosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6n7r, PDBe:6n7r, PDBj:6n7r
PDBsum6n7r
PubMed31485080
UniProtQ05900|RU1C_YEAST U1 small nuclear ribonucleoprotein C (Gene Name=YHC1)

[Back to BioLiP]