Structure of PDB 6n6k Chain B Binding Site BS02

Receptor Information
>6n6k Chain B (length=186) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGPNLII
KQPDELLDSMSDWCKEHHGKSGLTKAVKESTITLQQAEYEFLSFVRQQTP
PGLCPLAGNSVHEDKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEE
YEFAPKKAASHRALDDISESIKELQFYRNNIFKKKI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6n6k A dedicated diribonucleotidase resolves a key bottleneck for the terminal step of RNA degradation.
Resolution1.418 Å
Binding residue
(original residue number in PDB)		E17 M18 G20 L21 W64 C65 H69 S111 E114 S138 H162
Binding residue
(residue number reindexed from 1)		E16 M17 G19 L20 W63 C64 H68 S110 E113 S137 H161
Enzymatic activity
Enzyme Commision number 3.1.15.-
Gene Ontology
Molecular Function
GO:0000175 3'-5'-RNA exonuclease activity
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:6n6k, PDBe:6n6k, PDBj:6n6k
PDBsum6n6k
PubMed31225796
UniProtQ9Y3B8|ORN_HUMAN Oligoribonuclease, mitochondrial (Gene Name=REXO2)

[Back to BioLiP]