Structure of PDB 6n2w Chain B Binding Site BS02

Receptor Information
>6n2w Chain B (length=602) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSYTVTVATGSQEHAGTDDYIYLSLVGSAGCSEKHLLSFERGAVDSYDVT
VDEELGEIQLVRIEKRKYGSNDDWYLKYITLKTPHGDYIEFPCYRWITGD
VEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSID
AKCHKDLPRDIQFFVKISNTISERVMNHWQEDLMFGYQFLNGANPVLIRR
CTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDFLAA
PICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSS
DFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAIN
TKAREQLIGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYR
DDGLLVWEAIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRK
SSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNFGQYDWASWIPNAPPTM
RAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYP
EEHFIEKPVKEAMARFRKNLEAIVSVIAERNENLQLPYYYLSPDRIPNSV
AI
Ligand information
Ligand ID30Z
InChIInChI=1S/C18H22O4/c1-11(7-13-3-5-15(19)17(21)9-13)12(2)8-14-4-6-16(20)18(22)10-14/h3-6,9-12,19-22H,7-8H2,1-2H3/t11-,12-/m0/s1
InChIKeyHCZKYJDFEPMADG-RYUDHWBXSA-N
SMILES
SoftwareSMILES
CACTVS 3.385C[C@@H](Cc1ccc(O)c(O)c1)[C@@H](C)Cc2ccc(O)c(O)c2
OpenEye OEToolkits 1.9.2CC(Cc1ccc(c(c1)O)O)C(C)Cc2ccc(c(c2)O)O
OpenEye OEToolkits 1.9.2C[C@@H](Cc1ccc(c(c1)O)O)[C@@H](C)Cc2ccc(c(c2)O)O
CACTVS 3.385C[CH](Cc1ccc(O)c(O)c1)[CH](C)Cc2ccc(O)c(O)c2
ACDLabs 12.01Oc1ccc(cc1O)CC(C)C(C)Cc2ccc(O)c(O)c2
FormulaC18 H22 O4
Name4-[(2R,3S)-3-[(3,4-DIHYDROXYPHENYL)METHYL]-2-METHYLBUTYL]BENZENE-1,2-DIOL
ChEMBLCHEMBL4756087
DrugBank
ZINCZINC000000056472
PDB chain6n2w Chain B Residue 702 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6n2w Structural and mechanistic insights into 5-lipoxygenase inhibition by natural products.
Resolution2.71 Å
Binding residue
(original residue number in PDB)		F359 Q363 H372 P569 R596 W599 H600
Binding residue
(residue number reindexed from 1)		F302 Q306 H315 P498 R525 W528 H529
Annotation score1
Binding affinityBindingDB: IC50=100nM
Enzymatic activity
Catalytic site (original residue number in PDB) H367 H372 H550 N554 I673
Catalytic site (residue number reindexed from 1) H310 H315 H479 N483 I602
Enzyme Commision number 1.13.11.-
1.13.11.34: arachidonate 5-lipoxygenase.
Gene Ontology
Molecular Function
GO:0004051 arachidonate 5-lipoxygenase activity
GO:0004052 arachidonate 12(S)-lipoxygenase activity
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
GO:0016787 hydrolase activity
GO:0036403 arachidonate 8(S)-lipoxygenase activity
GO:0046872 metal ion binding
GO:0051213 dioxygenase activity
Biological Process
GO:0001676 long-chain fatty acid metabolic process
GO:0001937 negative regulation of endothelial cell proliferation
GO:0002232 leukocyte chemotaxis involved in inflammatory response
GO:0002523 leukocyte migration involved in inflammatory response
GO:0002540 leukotriene production involved in inflammatory response
GO:0006629 lipid metabolic process
GO:0006690 icosanoid metabolic process
GO:0006691 leukotriene metabolic process
GO:0006954 inflammatory response
GO:0006959 humoral immune response
GO:0016525 negative regulation of angiogenesis
GO:0019369 arachidonate metabolic process
GO:0019370 leukotriene biosynthetic process
GO:0019372 lipoxygenase pathway
GO:0030501 positive regulation of bone mineralization
GO:0034440 lipid oxidation
GO:0036336 dendritic cell migration
GO:0042593 glucose homeostasis
GO:0042759 long-chain fatty acid biosynthetic process
GO:0045598 regulation of fat cell differentiation
GO:0050727 regulation of inflammatory response
GO:0050728 negative regulation of inflammatory response
GO:0050796 regulation of insulin secretion
GO:0061044 negative regulation of vascular wound healing
GO:0061045 negative regulation of wound healing
GO:0106014 regulation of inflammatory response to wounding
GO:1900015 regulation of cytokine production involved in inflammatory response
GO:1900407 regulation of cellular response to oxidative stress
GO:1901753 leukotriene A4 biosynthetic process
GO:1903426 regulation of reactive oxygen species biosynthetic process
GO:1903573 negative regulation of response to endoplasmic reticulum stress
GO:1903671 negative regulation of sprouting angiogenesis
GO:1904999 positive regulation of leukocyte adhesion to arterial endothelial cell
GO:2001301 lipoxin biosynthetic process
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005641 nuclear envelope lumen
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016020 membrane
GO:0016363 nuclear matrix
GO:0031965 nuclear membrane
GO:0034774 secretory granule lumen
GO:0048471 perinuclear region of cytoplasm
GO:1904813 ficolin-1-rich granule lumen

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6n2w, PDBe:6n2w, PDBj:6n2w
PDBsum6n2w
PubMed32393899
UniProtP09917|LOX5_HUMAN Polyunsaturated fatty acid 5-lipoxygenase (Gene Name=ALOX5)

[Back to BioLiP]