Structure of PDB 6mj8 Chain B Binding Site BS02

Receptor Information
>6mj8 Chain B (length=99) Species: 5478 (Nakaseomyces glabratus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TIEIIKDLFEHLCGVRVHRTYEDDTGLWFDTSQGSKNGIMDYKLGFVTEV
IYVPLLKQRTAEELQELQKKLPDYLFETLSFPLRSLNQFYIKMSKSLNK
Ligand information
>6mj8 Chain D (length=20) Species: 5478 (Nakaseomyces glabratus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YIPPTILTKRRNMESFNDCK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mj8 The molecular basis of monopolin recruitment to the kinetochore.
Resolution3.03 Å
Binding residue
(original residue number in PDB)		F115 L163
Binding residue
(residue number reindexed from 1)		F46 L83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0033551 monopolin complex

View graph for
Cellular Component
External links
PDB RCSB:6mj8, PDBe:6mj8, PDBj:6mj8
PDBsum6mj8
PubMed31037469
UniProtQ6FVN3

[Back to BioLiP]