Structure of PDB 6m6s Chain B Binding Site BS02

Receptor Information
>6m6s Chain B (length=162) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NKIYKLMCSNCSKEFCKSIYIKKVFSNYMVFDPSVWRFLHVESKRKVSKY
LSEDNQPLSDIKCFHCKLDVGRAYKIRGTYLPQLSVKALTFVQESDYSSM
TKAKWSDVEQDLFYISEAIEDDFRIMLNALSDTEENIEKKIVLDLDSRQH
NKQLEMKRFHIQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6m6s Insights into the structure and RNA-binding specificity of Caenorhabditis elegans Dicer-related helicase 3 (DRH-3).
Resolution1.6 Å
Binding residue
(original residue number in PDB)		S970 N971 S992 K993 Y994 R1016 Y1018 Q1027 K1048 W1049 S1050
Binding residue
(residue number reindexed from 1)		S26 N27 S48 K49 Y50 R72 Y74 Q83 K104 W105 S106
Enzymatic activity
Enzyme Commision number 3.6.4.13: RNA helicase.
External links