Structure of PDB 6l6l Chain B Binding Site BS02

Receptor Information

>6l6l Chain B (length=84) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRR
RNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRL

Ligand information

>6l6l Chain D (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tataggtcacagtttgacctt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6l6l Structural basis of binding of homodimers of the nuclear receptor NR4A2 to selective Nur-responsive DNA elements.
Resolution	2.781 Å
Binding residue (original residue number in PDB)	C272 Q273 H274 Y275 K284 V333 R334 G340 R341 R342 G343
Binding residue (residue number reindexed from 1)	C11 Q12 H13 Y14 K23 V72 R73 G79 R80 R81 G82

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0008270	zinc ion binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6l6l, PDBe:6l6l, PDBj:6l6l
PDBsum	6l6l
PubMed	31723028
UniProt	P43354\|NR4A2_HUMAN Nuclear receptor subfamily 4 group A member 2 (Gene Name=NR4A2)

[Back to BioLiP]