Structure of PDB 6kco Chain B Binding Site BS02

Receptor Information
>6kco Chain B (length=83) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASYSIGDLVFAKVKGYPPWPAKITKSNNNKKYNVYFYGTGETANIKLEDL
FPYASNKERFATEKIMKRAKFIEAIDQIESALR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kco Shuguo PWWP in complex with ssDNA
Resolution2.4 Å
Binding residue
(original residue number in PDB)		V20 K21 Y23 W26 K38 F43 T46 E48 A50 N51 I52 K53
Binding residue
(residue number reindexed from 1)		V13 K14 Y16 W19 K31 F36 T39 E41 A43 N44 I45 K46
Enzymatic activity
Enzyme Commision number ?
External links