Structure of PDB 6kbz Chain B Binding Site BS02

Receptor Information
>6kbz Chain B (length=226) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CGRFAQSQTREDYLALLAEDIERDIPYDPEPIGRYNVAPGTKVLLLSERD
EHLHLDPVFWGYAPGWWDKPPLINARVETAATSRMFKPLWQHGRAICFAD
GWFEWKKEGDKKQPFFIYRADGQPIFMAAIGSTPFERGDEAEGFLIVTAA
ADQGLVDIHDRRPLVLSPEAAREWMRQEISGKEASEIAASGCVPANQFSW
HPVSRAVGNVKNQGAELIQPVLEVLF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kbz Molecular basis of abasic site sensing in single-stranded DNA by the SRAP domain of E. coli yedK.
Resolution1.653 Å
Binding residue
(original residue number in PDB)		P40 G41 T42 P71 V211
Binding residue
(residue number reindexed from 1)		P39 G40 T41 P70 V210
Enzymatic activity
Enzyme Commision number 3.4.-.-
4.-.-.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003697 single-stranded DNA binding
GO:0008233 peptidase activity
GO:0016829 lyase activity
GO:0160129 protein-DNA covalent cross-linking activity
Biological Process
GO:0006508 proteolysis
GO:0006974 DNA damage response
GO:0009432 SOS response
GO:0106300 protein-DNA covalent cross-linking repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6kbz, PDBe:6kbz, PDBj:6kbz
PDBsum6kbz
PubMed31504793
UniProtP76318|YEDK_ECOLI Abasic site processing protein YedK (Gene Name=yedK)

[Back to BioLiP]