Structure of PDB 6jxd Chain B Binding Site BS02

Receptor Information
>6jxd Chain B (length=80) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY
TEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>6jxd Chain J (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
catatatgccggtctcacacgtgcctggagactagtaagcgcttctagtg
gcggttaaaacgcggtagacagcgcgtacgtgcgtttaagcggtgctaga
gctgtctacgaccaattgagcggcctcggcaccgggatatatggtac
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jxd PARP1 exhibits enhanced association and catalytic efficiency with gamma H2A.X-nucleosome.
Resolution2.25 Å
Binding residue
(original residue number in PDB)
R35 R45 I46 S47 G48 R78 K79 T80
Binding residue
(residue number reindexed from 1)
R13 R23 I24 S25 G26 R56 K57 T58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity

View graph for
Molecular Function
External links
PDB RCSB:6jxd, PDBe:6jxd, PDBj:6jxd
PDBsum6jxd
PubMed31848352
UniProtP62805|H4_HUMAN Histone H4 (Gene Name=H4C1)

[Back to BioLiP]