Structure of PDB 6j4f Chain B Binding Site BS02

Receptor Information
>6j4f Chain B (length=63) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APAEDGYNWRKYGQKLVKGSEYPRSYYKCTNPNCQVKKKVERSREGHITE
IIYKGAHNHLKPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j4f Crystal structure of the AtWRKY2 domain
Resolution2.4 Å
Binding residue
(original residue number in PDB)
Y281 K284 V286 R293 Y295 K306
Binding residue
(residue number reindexed from 1)
Y12 K15 V17 R24 Y26 K37
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:6j4f, PDBe:6j4f, PDBj:6j4f
PDBsum6j4f
PubMed
UniProtQ9FG77|WRKY2_ARATH Probable WRKY transcription factor 2 (Gene Name=WRKY2)

[Back to BioLiP]