Structure of PDB 6j4e Chain B Binding Site BS02

Receptor Information
>6j4e Chain B (length=61) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VMEDGYNWRKYGQKLVKGNEFVRSYYRCTHPNCKAKKQLERSAGGQVVDT
VYFGEHDHPKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j4e Crystal structure of the AtWRKY1 domain
Resolution3.126 Å
Binding residue
(original residue number in PDB)		Y119 K122 V124 K125 R131 Y133 R135
Binding residue
(residue number reindexed from 1)		Y11 K14 V16 K17 R23 Y25 R27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6j4e, PDBe:6j4e, PDBj:6j4e
PDBsum6j4e
PubMed
UniProtQ9SI37|WRKY1_ARATH WRKY transcription factor 1 (Gene Name=WRKY1)

[Back to BioLiP]