Structure of PDB 6irq Chain B Binding Site BS02

Receptor Information
>6irq Chain B (length=101) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RGVNKVILVGNVGGDPETRYMPNGNAVTNITLATSESERTEWHRVVFFGR
LAEIAGEYLRKGSQVYVEGSLRTRKWQGQDGQDRYTTEIVVDINGNMQLL
G
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6irq Characterization of an SSB-dT25 complex: structural insights into the S-shaped ssDNA binding conformation.
Resolution1.91 Å
Binding residue
(original residue number in PDB)		N13 G15 T33 A35 W54 R56 K73 G74 Q91
Binding residue
(residue number reindexed from 1)		N11 G13 T31 A33 W42 R44 K61 G62 Q79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003697 single-stranded DNA binding
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6irq, PDBe:6irq, PDBj:6irq
PDBsum6irq
PubMed
UniProtP40947|SSB_PSEAE Single-stranded DNA-binding protein (Gene Name=ssb)

[Back to BioLiP]