Structure of PDB 6iiq Chain B Binding Site BS02

Receptor Information
>6iiq Chain B (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARPRPREYKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGT
HETAFLGPKDLFPYKEYKDKFGKSNKRKGFNEGLWEIENNPGVKFTGY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6iiq Complex structure of the HRP3 PWWP domain with a 16-bp TA-rich DNA
Resolution1.85 Å
Binding residue
(original residue number in PDB)
K77 R78 K79
Binding residue
(residue number reindexed from 1)
K76 R77 K78
Binding affinityPDBbind-CN: Kd=1.3uM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6iiq, PDBe:6iiq, PDBj:6iiq
PDBsum6iiq
PubMed
UniProtQ9Y3E1|HDGR3_HUMAN Hepatoma-derived growth factor-related protein 3 (Gene Name=HDGFL3)

[Back to BioLiP]