Structure of PDB 6htu Chain B Binding Site BS02

Receptor Information
>6htu Chain B (length=76) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMNKSEISQVFEIALKRNLPVNFEVARESGPPHMKNFVTKVSVGEFVGEG
EGKSKKISKKNAAIAVLEELKKLPPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6htu The crystal structure of Staufen1 in complex with a physiological RNA sheds light on substrate selectivity.
Resolution2.888 Å
Binding residue
(original residue number in PDB)
M181 E191 L194 F216 K232 S233 K234
Binding residue
(residue number reindexed from 1)
M2 E12 L15 F37 K53 S54 K55
Binding affinityPDBbind-CN: Kd=14nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6htu, PDBe:6htu, PDBj:6htu
PDBsum6htu
PubMed30456389
UniProtO95793|STAU1_HUMAN Double-stranded RNA-binding protein Staufen homolog 1 (Gene Name=STAU1)

[Back to BioLiP]