Structure of PDB 6gy3 Chain B Binding Site BS02

Receptor Information

>6gy3 Chain B (length=202) Species: 1718 (Corynebacterium glutamicum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NPREEILDASAELFTRQGFATTSTHQIADAVGIRQASLYYHFPSKTEIFL
TLLKSTVEPSTVLAEDLSTLDAGPEMRLWAIVASEVRLLLSTKWNVGRLY
QLPIVGSEEFAEYHSQREALTNVFRDLATEIVGDDPRAELPFHITMSVIE
MRRNDGKIPSPLSADSLPETAIMLADASLAVLGAPLPADRVEKTLELIKQ
AD

Ligand information

>6gy3 Chain D (length=18) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gtctatcgatctatagac

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6gy3 The role of DNA flexibility in transcription regulator AmtR-DNA interaction
Resolution	2.68 Å
Binding residue (original residue number in PDB)	S41 T42 Q53 Y57 S62 K63
Binding residue (residue number reindexed from 1)	S23 T24 Q35 Y39 S44 K45

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6gy3, PDBe:6gy3, PDBj:6gy3
PDBsum	6gy3
PubMed
UniProt	Q79VH8

[Back to BioLiP]