Structure of PDB 6gcf Chain B Binding Site BS02

Receptor Information
>6gcf Chain B (length=148) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SIQPWIEKFIKQAQQQRSQSTKDYPTSYRNLRVKLSFGYGNFTSIPWFAF
LGEGQEASNGIYPVILYYKDFDELVLAYGISDTNEPHAQWQFSSDIPKTI
AEYFQATSGVYPKKYGQSYYACSQKVSQGIDYTRFASMLDNIINDYKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gcf Recognition of modified cytosine variants by the DNA-binding domain of methyl-directed endonuclease McrBC.
Resolution1.55 Å
Binding residue
(original residue number in PDB)
S20 Q21 S22 K24 Y41 G42 N43
Binding residue
(residue number reindexed from 1)
S18 Q19 S20 K22 Y39 G40 N41
Enzymatic activity
Enzyme Commision number 3.1.21.-
External links
PDB RCSB:6gcf, PDBe:6gcf, PDBj:6gcf
PDBsum6gcf
PubMed30194838
UniProtP15005|MCRB_ECOLI Type IV methyl-directed restriction enzyme EcoKMcrB subunit (Gene Name=mcrB)

[Back to BioLiP]