Structure of PDB 6gcd Chain B Binding Site BS02

Receptor Information
>6gcd Chain B (length=153) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MESIQPWIEKFIKQAQQQRSQSTKDYPTSYRNLRVKLSFGYGNFTSIPWF
AFLGEGQEASNGIYPVILYYKDFDELVLAYGISDTNEPHAQWQFSSDIPK
TIAEYFQATSGVYPKKYGQSYYACSQKVSQGIDYTRFASMLDNIINDYKL
IFN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gcd Recognition of modified cytosine variants by the DNA-binding domain of methyl-directed endonuclease McrBC.
Resolution1.8 Å
Binding residue
(original residue number in PDB)
Q21 S22 T23 K24 Y41 G42 N43
Binding residue
(residue number reindexed from 1)
Q21 S22 T23 K24 Y41 G42 N43
Enzymatic activity
Enzyme Commision number 3.1.21.-
External links
PDB RCSB:6gcd, PDBe:6gcd, PDBj:6gcd
PDBsum6gcd
PubMed30194838
UniProtP15005|MCRB_ECOLI Type IV methyl-directed restriction enzyme EcoKMcrB subunit (Gene Name=mcrB)

[Back to BioLiP]