Structure of PDB 6fqp Chain B Binding Site BS02

Receptor Information
>6fqp Chain B (length=66) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCN
WFINARRRLLPDMLRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fqp TGIF1 homeodomain interacts with Smad MH1 domain and represses TGF-beta signaling.
Resolution2.42 Å
Binding residue
(original residue number in PDB)		R165 R167 N170 L171 Q210 N217 R221
Binding residue
(residue number reindexed from 1)		R2 R4 N7 L8 Q47 N54 R58
Binding affinityPDBbind-CN: Kd=169.9nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6fqp, PDBe:6fqp, PDBj:6fqp
PDBsum6fqp
PubMed30060237
UniProtQ15583|TGIF1_HUMAN Homeobox protein TGIF1 (Gene Name=TGIF1)

[Back to BioLiP]