Structure of PDB 6fnz Chain B Binding Site BS02

Receptor Information
>6fnz Chain B (length=81) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KDFVRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLETG
VVKKLYTLDGKQVTCLHDFFGDDDVFIACGP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fnz Domain swap in the C-terminal ubiquitin-like domain of human doublecortin.
Resolution2.23 Å
Binding residue
(original residue number in PDB)		Y310 L312
Binding residue
(residue number reindexed from 1)		Y56 L58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0035556 intracellular signal transduction

View graph for
Biological Process
External links
PDB RCSB:6fnz, PDBe:6fnz, PDBj:6fnz
PDBsum6fnz
PubMed29717716
UniProtO43602|DCX_HUMAN Neuronal migration protein doublecortin (Gene Name=DCX)

[Back to BioLiP]