Structure of PDB 6edb Chain B Binding Site BS02

Receptor Information

>6edb Chain B (length=67) Species: 9606 (Homo sapiens)

KRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFF
QEAQKLQAMHREKYPNY

Ligand information

>6edb Chain D (length=21)

gcattgtttagatcccggatc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6edb Human cGAS catalytic domain has an additional DNA-binding interface that enhances enzymatic activity and liquid-phase condensation.
• Resolution: 3.209 Å
• Binding residue (original residue number in PDB): F12 S33 S36 W43
• Binding residue (residue number reindexed from 1): F7 S28 S31 W38

Enzymatic activity

• Enzyme Commision number: 2.7.7.86: cyclic GMP-AMP synthase.

External links

• PDB: RCSB:6edb, PDBe:6edb, PDBj:6edb
• PDBsum: 6edb
• PubMed: 31142647
• UniProt: Q05066|SRY_HUMAN Sex-determining region Y protein (Gene Name=SRY);
  Q8N884|CGAS_HUMAN Cyclic GMP-AMP synthase (Gene Name=CGAS)