Structure of PDB 6dei Chain B Binding Site BS02

Receptor Information
>6dei Chain B (length=105) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHSGGSSDDYSIMDYKL
GFVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIA
KSLNK
Ligand information
>6dei Chain D (length=17) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TLKLKKRLESVPELFLH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dei The budding-yeast RWD protein Csm1 scaffolds diverse protein complexes through a conserved structural mechanism.
Resolution1.699 Å
Binding residue
(original residue number in PDB)		E72 D76 E79 Y80 N83 V84 R85 H87 D99 I100 S101 Y113 I115 D117 K119 V137 Q140 R141
Binding residue
(residue number reindexed from 1)		E2 D6 E9 Y10 N13 V14 R15 H17 D29 I30 S31 Y43 I45 D47 K49 V61 Q64 R65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0033551 monopolin complex

View graph for
Cellular Component
External links
PDB RCSB:6dei, PDBe:6dei, PDBj:6dei
PDBsum6dei
PubMed30252178
UniProtP25651|CSM1_YEAST Monopolin complex subunit CSM1 (Gene Name=CSM1)

[Back to BioLiP]