Structure of PDB 6dat Chain B Binding Site BS02

Receptor Information
>6dat Chain B (length=135) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQ
SFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNI
IHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Ligand information
>6dat Chain F (length=16) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PSFDSFDFEDFPAALW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dat The Biophysical Basis for Phosphorylation-Enhanced DNA-Binding Autoinhibition of the ETS1 Transcription Factor.
Resolution2.35003 Å
Binding residue
(original residue number in PDB)		Q336 L337 K381 K383 K388 Y395 Y396
Binding residue
(residue number reindexed from 1)		Q35 L36 K80 K82 K87 Y94 Y95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6dat, PDBe:6dat, PDBj:6dat
PDBsum6dat
PubMed30597162
UniProtP27577|ETS1_MOUSE Protein C-ets-1 (Gene Name=Ets1)

[Back to BioLiP]