Structure of PDB 6cnq Chain B Binding Site BS02

Receptor Information
>6cnq Chain B (length=68) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL
GNTVDLSSFDFRTGKMMP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6cnq Structural basis for the ability of MBD domains to bind methyl-CG and TG sites in DNA.
Resolution2.151 Å
Binding residue
(original residue number in PDB)
R166 K167 S168 L170 S171 D176 K186
Binding residue
(residue number reindexed from 1)
R19 K20 S21 L23 S24 D29 K39
Binding affinityPDBbind-CN: Kd=0.9uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6cnq, PDBe:6cnq, PDBj:6cnq
PDBsum6cnq
PubMed29567833
UniProtQ9UBB5|MBD2_HUMAN Methyl-CpG-binding domain protein 2 (Gene Name=MBD2)

[Back to BioLiP]