Structure of PDB 6cev Chain B Binding Site BS02

Receptor Information
>6cev Chain B (length=70) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLA
RYLGGSMDLSTFDFRTGKML
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6cev Structural analyses reveal that MBD3 is a methylated CG binder.
Resolution2.005 Å
Binding residue
(original residue number in PDB)
R22 R23 S24 L26 S27 D32 K42
Binding residue
(residue number reindexed from 1)
R22 R23 S24 L26 S27 D32 K42
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6cev, PDBe:6cev, PDBj:6cev
PDBsum6cev
PubMed30980593
UniProtO95983|MBD3_HUMAN Methyl-CpG-binding domain protein 3 (Gene Name=MBD3)

[Back to BioLiP]