Structure of PDB 6bjg Chain B Binding Site BS02

Receptor Information
>6bjg Chain B (length=146) Species: 39443 (Carnation Italian ringspot virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MERAIQGNDTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLYNDETQ
DNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFL
GANQVGCHYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLTP
Ligand information
>6bjg Chain D (length=21) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cguacgcggaauacuucgauu
.....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bjg Structural insights into interactions between viral suppressor of RNA silencing protein p19 mutants and small RNAs.
Resolution2.29 Å
Binding residue
(original residue number in PDB)		R11 W39 K67 H111 S113 R115 S120
Binding residue
(residue number reindexed from 1)		R11 W39 K64 H108 S110 R112 S117
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0019049 virus-mediated perturbation of host defense response
GO:0052170 symbiont-mediated suppression of host innate immune response
Cellular Component
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6bjg, PDBe:6bjg, PDBj:6bjg
PDBsum6bjg
PubMed31021526
UniProtQ66104|P19_CIRV RNA silencing suppressor p19 (Gene Name=ORF4)

[Back to BioLiP]