Structure of PDB 6bba Chain B Binding Site BS02

Receptor Information

>6bba Chain B (length=185) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFL
QSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGS
LLLAAGTPGMRHSLPNSRIMIHQPSAIQAEEIMKLKKQLYNIYAKHTKQS
LQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQD

Ligand information

>6bba Chain J (length=7) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tFTPuAP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6bba Acyldepsipeptide Analogs Dysregulate Human Mitochondrial ClpP Protease Activity and Cause Apoptotic Cell Death.
Resolution	2.796 Å
Binding residue (original residue number in PDB)	L147 S151 T178 Y181
Binding residue (residue number reindexed from 1)	L48 S52 T79 Y82

Enzymatic activity

Enzyme Commision number

3.4.21.92: endopeptidase Clp.

Gene Ontology

	Molecular Function
GO:0004176	ATP-dependent peptidase activity
GO:0004252	serine-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6bba, PDBe:6bba, PDBj:6bba
PDBsum	6bba
PubMed	30126533
UniProt	Q16740\|CLPP_HUMAN ATP-dependent Clp protease proteolytic subunit, mitochondrial (Gene Name=CLPP)

[Back to BioLiP]