Structure of PDB 5zmc Chain B Binding Site BS02

Receptor Information
>5zmc Chain B (length=106) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNK
PKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHA
MLDVKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zmc Structural basis for reactivating the mutant TERT promoter by cooperative binding of p52 and ETS1.
Resolution2.99 Å
Binding residue
(original residue number in PDB)		Q336 L337 W375 K388 R391 Y395 Y396
Binding residue
(residue number reindexed from 1)		Q5 L6 W44 K57 R60 Y64 Y65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5zmc, PDBe:5zmc, PDBj:5zmc
PDBsum5zmc
PubMed30093619
UniProtP14921|ETS1_HUMAN Protein C-ets-1 (Gene Name=ETS1)

[Back to BioLiP]