Structure of PDB 5zgn Chain B Binding Site BS02

Receptor Information
>5zgn Chain B (length=82) Species: 1125630 (Klebsiella pneumoniae subsp. pneumoniae HS11286) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKQRIDLRLTDDDKSIIEEAAAISNQTITQFVVASASERAAEVIEQHRRM
VLNEQSWSLVMEAITQPPAPNDRLKRAAKRLQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zgn The crystal structure of KacTA-DNA complex
Resolution2.24 Å
Binding residue
(original residue number in PDB)		K18 T31 I32 T33
Binding residue
(residue number reindexed from 1)		K14 T27 I28 T29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:5zgn, PDBe:5zgn, PDBj:5zgn
PDBsum5zgn
PubMed
UniProtA0A0H3GLZ1

[Back to BioLiP]