Structure of PDB 5z98 Chain B Binding Site BS02

Receptor Information

>5z98 Chain B (length=182) Species: 9598 (Pan troglodytes) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ALLTAETFRLQFNNRRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKK
KCHAEICFINEIKSMGLDETQCYQVTCYLTWSPCSSCAWKLVDFIQAHDH
LNLRIFASRLYYHWCKPQQEGLRLLCGSQVPVEVMGLPEFNDCWENFVDH
EKPLSFDPCKMLEELDKNSRAIKRRLERIKQS

Ligand information

>5z98 Chain D (length=10) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

auacccggca

..........

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5z98 Structural basis of chimpanzee APOBEC3H dimerization stabilized by double-stranded RNA.
Resolution	2.2 Å
Binding residue (original residue number in PDB)	R26 W82 L111 Y113 W115
Binding residue (residue number reindexed from 1)	R25 W81 L110 Y112 W114

Enzymatic activity

Enzyme Commision number

3.5.4.38: single-stranded DNA cytosine deaminase.

Gene Ontology

	Molecular Function
GO:0003824	catalytic activity
GO:0008270	zinc ion binding
GO:0016787	hydrolase activity
GO:0046872	metal ion binding

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:5z98, PDBe:5z98, PDBj:5z98
PDBsum	5z98
PubMed	30060196
UniProt	B7T0U6

[Back to BioLiP]