Structure of PDB 5yis Chain B Binding Site BS02

Receptor Information
>5yis Chain B (length=122) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFL
VPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESER
DEDGFLYMVYASQETFGTAMAV
Ligand information
>5yis Chain C (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VEEEWVIVSDEEIEEARQKAPLEITE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yis Potent and specific Atg8-targeting autophagy inhibitory peptides from giant ankyrins.
Resolution2.201 Å
Binding residue
(original residue number in PDB)		T6 Q9 K39 N84 H86 M88 A122 M123 A124
Binding residue
(residue number reindexed from 1)		T3 Q6 K36 N81 H83 M85 A119 M120 A121
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0000423 mitophagy
GO:0006914 autophagy
GO:0009267 cellular response to starvation
GO:0051649 establishment of localization in cell
GO:0070254 mucus secretion
GO:0070257 positive regulation of mucus secretion
Cellular Component
GO:0000421 autophagosome membrane
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005776 autophagosome
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0005930 axoneme
GO:0012505 endomembrane system
GO:0016020 membrane
GO:0031410 cytoplasmic vesicle
GO:0031966 mitochondrial membrane
GO:0044754 autolysosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5yis, PDBe:5yis, PDBj:5yis
PDBsum5yis
PubMed29867141
UniProtQ9CQV6|MLP3B_MOUSE Microtubule-associated proteins 1A/1B light chain 3B (Gene Name=Map1lc3b)

[Back to BioLiP]