Structure of PDB 5yel Chain B Binding Site BS02

Receptor Information
>5yel Chain B (length=168) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPYECYICHARFTQSGTMKMHILQKHVAKFHCPHCDTVIARKSDLGVHLR
KQHSYIEQGKKCRYCDAVFHERYALIQHQKSHKNEKRFKCDQCDYASRQE
RHMIMHKRTHTGKPYACSHCDKTFRQKQLLDMHFKRYHDPVPAAFVCSKC
GKTFTRRNTMARHADNCA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yel Molecular mechanism of directional CTCF recognition of a diverse range of genomic sites
Resolution2.96 Å
Binding residue
(original residue number in PDB)
K423 S450 R470 R494 R508 L537 R566 R567 N568
Binding residue
(residue number reindexed from 1)
K19 S43 R63 R87 R101 L129 R156 R157 N158
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5yel, PDBe:5yel, PDBj:5yel
PDBsum5yel
PubMed29076501
UniProtP49711|CTCF_HUMAN Transcriptional repressor CTCF (Gene Name=CTCF)

[Back to BioLiP]