Structure of PDB 5yej Chain B Binding Site BS02

Receptor Information
>5yej Chain B (length=165) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLHKPDVVAAATKILDDHGIADLTMRRLARELDVTPGALYWHFANKQELL
GAVADHILRTARTDTDLAWREQIHESCRALRDALLSHTDGAELVSASFAS
GQSVVITEIVEQLGRAARAAGVSDADVDAAARTVIYYVLGFTVDEQSRRQ
FRFGLQLLVDGLAAH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yej Structural insights into operator recognition by BioQ in the Mycobacterium smegmatis biotin synthesis pathway.
Resolution2.698 Å
Binding residue
(original residue number in PDB)		L3 V35 T36 A39 W42 H43
Binding residue
(residue number reindexed from 1)		L2 V34 T35 A38 W41 H42
Binding affinityPDBbind-CN: Kd=13.8nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0046677 response to antibiotic

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5yej, PDBe:5yej, PDBj:5yej
PDBsum5yej
PubMed29852200
UniProtA0QX69

[Back to BioLiP]