Structure of PDB 5x5l Chain B Binding Site BS02

Receptor Information
>5x5l Chain B (length=95) Species: 470 (Acinetobacter baumannii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NKLYKNIETDTHSVYILLNLTLTEYKIISFMIDQPHKVFTRGELMNHCMN
DSDALERTVDSHVSKLRKKLEEQGIFQMLINVRGVGYRLDNPLAV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5x5l Mechanistic insight into how multidrug resistant Acinetobacter baumannii response regulator AdeR recognizes an intercistronic region.
Resolution2.75 Å
Binding residue
(original residue number in PDB)		T169 T171 N198 A202 T206 S209 H210 R231
Binding residue
(residue number reindexed from 1)		T21 T23 N50 A54 T58 S61 H62 R83
Binding affinityPDBbind-CN: Kd=2.2uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5x5l, PDBe:5x5l, PDBj:5x5l
PDBsum5x5l
PubMed28934482
UniProtE1A0Z5

[Back to BioLiP]