Structure of PDB 5wwc Chain B Binding Site BS02

Receptor Information
>5wwc Chain B (length=59) Species: 273057 (Saccharolobus solfataricus P2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSGKKPVKVKTPAGKEAELVPEKVWAMAPKGRKGVKIGLFKDPETGKYFR
HKLPDDYPI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wwc Roles of Leu28 side chain intercalation in the interaction between Cren7 and DNA
Resolution1.9 Å
Binding residue
(original residue number in PDB)		K24 W26 M28 A29 P30 Y49 R51
Binding residue
(residue number reindexed from 1)		K23 W25 M27 A28 P29 Y48 R50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5wwc, PDBe:5wwc, PDBj:5wwc
PDBsum5wwc
PubMed28377493
UniProtQ97ZE3|CREN7_SACS2 Chromatin protein Cren7 (Gene Name=creN7)

[Back to BioLiP]