Structure of PDB 5w9q Chain B Binding Site BS02

Receptor Information
>5w9q Chain B (length=54) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QNRKCGCAACLRRMDCGRCDFCCDKPKFGGSNQKRQKCRWRQCLQFAMKR
LLPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5w9q DNA Sequence Recognition of Human CXXC Domains and Their Structural Determinants.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		R369 R384
Binding residue
(residue number reindexed from 1)		R35 R50
Binding affinityPDBbind-CN: Kd=0.6uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:5w9q, PDBe:5w9q, PDBj:5w9q
PDBsum5w9q
PubMed29276034
UniProtQ9UIS9|MBD1_HUMAN Methyl-CpG-binding domain protein 1 (Gene Name=MBD1)

[Back to BioLiP]