Structure of PDB 5w7y Chain B Binding Site BS02

Receptor Information
>5w7y Chain B (length=103) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGFELQPRDGGPRVALAPGETVIGRGPLLGITDKRVSRRHAILEVAGGQL
RIKPIHTNPCFYQSSEKSQLLPLKPNLWCYLNPGDSFSLLVDKYIFRILS
IPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5w7y Characterization of the APLF FHA-XRCC1 phosphopeptide interaction and its structural and functional implications.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		R27 G28 P29 G32 I33 T34 K36 S39 R40 H58 N60
Binding residue
(residue number reindexed from 1)		R25 G26 P27 G30 I31 T32 K34 S37 R38 H56 N58
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0008408 3'-5' exonuclease activity
Biological Process
GO:0006302 double-strand break repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5w7y, PDBe:5w7y, PDBj:5w7y
PDBsum5w7y
PubMed29059378
UniProtQ8IW19|APLF_HUMAN Aprataxin and PNK-like factor (Gene Name=APLF)

[Back to BioLiP]