Structure of PDB 5vww Chain B Binding Site BS02

Receptor Information
>5vww Chain B (length=142) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEEQVAQDTEEVFRSYVFYRHQQPSSTMGQVGRQLAIIGDDINRRYDSEF
QTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVY
QHGLTGFLGQVTRFVVDFMLHHSIARWIAQRGGWVAALNLGN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vww Conversion of Bim-BH3 from Activator to Inhibitor of Bak through Structure-Based Design.
Resolution2.802 Å
Binding residue
(original residue number in PDB)		I81 I85 Y89 E92 F93 M96 L100 I114 S117 L118 N124 R127 F134
Binding residue
(residue number reindexed from 1)		I38 I42 Y46 E49 F50 M53 L57 I71 S74 L75 N81 R84 F91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:5vww, PDBe:5vww, PDBj:5vww
PDBsum5vww
PubMed29149594
UniProtQ16611|BAK_HUMAN Bcl-2 homologous antagonist/killer (Gene Name=BAK1)

[Back to BioLiP]