Structure of PDB 5u91 Chain B Binding Site BS02

Receptor Information

>5u91 Chain B (length=327) Species: 32630 (synthetic construct)

PADATSDEVRKNLMDVFRDRPAFSEHTWEMLLSVCRSWAAWCKLNNRKWF
PAEPEDVRDYLLHLQARGLAVKTIQQHLCRLNMLHRRSGLPRPSDSNAVS
LVMRRIRKENVDAGERTKQALAFERTDFDQVRSLMENSDRCQDIRNLAFL
GVAYNTLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALS
LGVTKLVERWISVSGVADDPNNYLFCRVRRYGVAAPSATSQLSTYALQRI
FEATHRLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGG
WTTVNSVMNFIRNLDSETGAMVRLLED

Ligand information

>5u91 Chain D (length=37)

ggccatgttggcatatagggtgtaataggatgttgtc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5u91 Crystal structure of an engineered, HIV-specific recombinase for removal of integrated proviral DNA.
• Resolution: 3.104 Å
• Binding residue (original residue number in PDB): F37 S38 H40 Q89 Q90 R94 M97 R100 S108 R118 R121 I174 A175 K201 R243 Q262 R282 Y283 S287 G288
• Binding residue (residue number reindexed from 1): F23 S24 H26 Q75 Q76 R80 M83 R86 S94 R104 R107 I160 A161 K187 R229 Q248 R268 Y269 S273 G274

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 23:37:10 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '5u91', asym_id = 'B', bs = 'BS02', title = 'Crystal structure of an engineered, HIV-specific recombinase for removal of integrated proviral DNA.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='5u91', asym_id='B', bs='BS02', title='Crystal structure of an engineered, HIV-specific recombinase for removal of integrated proviral DNA.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003677,0006310,0015074', uniprot = '', pdbid = '5u91', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0006310,0015074', uniprot='', pdbid='5u91', asym_id='B')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>