Structure of PDB 5trd Chain B Binding Site BS02

Receptor Information
>5trd Chain B (length=215) Species: 273075 (Thermoplasma acidophilum DSM 1728) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YYRAIKKIKEAAEASNRAYLTSSKLADMLGISQQSASRIIIDLEKNGYIT
RTVTKRGQILNITEKGLDVLYTEFADLSRILAIKNNVVITGTVTSGMGEG
RYYVARKQYIIQFQEKLGIIPYLGTLNIKVDQASLPELRKIRGFRGIHIE
GFKTEDRTFGSVKAFPAKIQNIPCFVIMPERTVYTDVIEIISDKYLREEI
NLHDGDRVSVEVYTE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5trd Structure of RbkR (Riboflavin Kinase) from Thermoplasma acidophilum determined in complex with CTP and its cognate DNA operator
Resolution1.85 Å
Binding residue
(original residue number in PDB)		S38 Q40 S41
Binding residue
(residue number reindexed from 1)		S32 Q34 S35
Enzymatic activity
Enzyme Commision number 2.7.1.161: CTP-dependent riboflavin kinase.
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0003677 DNA binding
GO:0008531 riboflavin kinase activity
GO:0016301 kinase activity
GO:0016773 phosphotransferase activity, alcohol group as acceptor
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0009231 riboflavin biosynthetic process
GO:0009398 FMN biosynthetic process
GO:0016310 phosphorylation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5trd, PDBe:5trd, PDBj:5trd
PDBsum5trd
PubMed
UniProtQ9HJA6|RIFK_THEAC Riboflavin kinase (Gene Name=ribK)

[Back to BioLiP]