Structure of PDB 5obt Chain B Binding Site BS02

Receptor Information

>5obt Chain B (length=230) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FQSGTRWAVLVAGSSGYWNYRHQADICHAYQLLRKGGLKEENIVVFMYDD
IANNYENPRPGTIINSPHGKDVYQGVPKDYTGDDVNVDNLFAVILGDKTA
VKGGSGKVVDSGPNDHIFIFYSDHGGPGVLGMPTSPYLYANDLNDVLKKK
HALGTYKSLVFYLEACESGSIFEGLLPEGLNIYATTASNAEESSWGTYCP
GEEPSPPPEYETCLGDLYSVAWMEDSGMHN

Ligand information

>5obt Chain D (length=4) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

YVAD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5obt Structural analyses ofArabidopsis thalianalegumain gamma reveal differential recognition and processing of proteolysis and ligation substrates.
Resolution	1.5 Å
Binding residue (original residue number in PDB)	R74 H75 H177 C219 S247 W248 G249 E255 D269
Binding residue (residue number reindexed from 1)	R21 H22 H124 C166 S194 W195 G196 E202 D216

Enzymatic activity

Enzyme Commision number

3.4.22.34: legumain.

Gene Ontology

	Molecular Function
GO:0008233	peptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5obt, PDBe:5obt, PDBj:5obt
PDBsum	5obt
PubMed	29628443
UniProt	Q39119\|VPEG_ARATH Vacuolar-processing enzyme gamma-isozyme (Gene Name=At4g32940)

[Back to BioLiP]