Structure of PDB 5nj8 Chain B Binding Site BS02

Receptor Information

>5nj8 Chain B (length=174) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DKERLARENHSEIERRRRNKMTAYITELSDMVPTCPDKLTILRMAVSHMK
SLRGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLN
QPQSEWFGSTLYDQVHPDDVDKLREQLSTSSRRSFICRMRCHFVVVHCTG
YIKAWPDDDPEAKFCLVAIGRLQV

Ligand information

>5nj8 Chain F (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggttgcgtgacc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5nj8 Structural Basis for Aryl Hydrocarbon Receptor-Mediated Gene Activation.
Resolution	3.3 Å
Binding residue (original residue number in PDB)	R88 H94 R102 D127 K128
Binding residue (residue number reindexed from 1)	R4 H10 R18 D37 K38
Binding affinity	PDBbind-CN: Kd=90nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0046983	protein dimerization activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus
GO:0005667	transcription regulator complex
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5nj8, PDBe:5nj8, PDBj:5nj8
PDBsum	5nj8
PubMed	28602820
UniProt	P27540\|ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator (Gene Name=ARNT)

[Back to BioLiP]