Structure of PDB 5new Chain B Binding Site BS02

Receptor Information
>5new Chain B (length=64) Species: 585035 (Escherichia coli S88) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMV
YKHAISTVVPSRPV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5new Intermolecular base stacking mediates RNA-RNA interaction in a crystal structure of the RNA chaperone Hfq.
Resolution2.511 Å
Binding residue
(original residue number in PDB)		F42 Y55 H57
Binding residue
(residue number reindexed from 1)		F38 Y51 H53
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003677 DNA binding
GO:0003681 bent DNA binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0140691 RNA folding chaperone
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0008033 tRNA processing
GO:0034337 RNA folding
GO:0040033 sRNA-mediated post-transcriptional gene silencing
GO:0043487 regulation of RNA stability
GO:0045974 regulation of translation, ncRNA-mediated
GO:0045975 positive regulation of translation, ncRNA-mediated
Cellular Component
GO:0005829 cytosol
GO:0043590 bacterial nucleoid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5new, PDBe:5new, PDBj:5new
PDBsum5new
PubMed28852099
UniProtP0A6X3|HFQ_ECOLI RNA-binding protein Hfq (Gene Name=hfq)

[Back to BioLiP]