Structure of PDB 5nc7 Chain B Binding Site BS02

Receptor Information
>5nc7 Chain B (length=110) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGR
KIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFA
SAMMHALEVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5nc7 Designed nanomolar small-molecule inhibitors of Ena/VASP EVH1 interaction impair invasion and extravasation of breast cancer cells.
Resolution2.7 Å
Binding residue
(original residue number in PDB)
R34 Y38 R47 R51 N61 A63
Binding residue
(residue number reindexed from 1)
R33 Y37 R46 R50 N60 A62
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5nc7, PDBe:5nc7, PDBj:5nc7
PDBsum5nc7
PubMed33184177
UniProtQ8N8S7|ENAH_HUMAN Protein enabled homolog (Gene Name=ENAH)

[Back to BioLiP]