Structure of PDB 5m0i Chain B Binding Site BS02

Receptor Information
>5m0i Chain B (length=238) Species: 285006 (Saccharomyces cerevisiae RM11-1a) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LGSDIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFER
TTLIKFVKKLRFYNDSVLSYNASEFINEGKNELDPEADSFDKVILPIASM
FVKSVETFDLLNYYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFV
KFSQWMIESLRIGSNLLDLEVVQFAIKSADEDGTDNIFLQEILPVNSEEE
FQTLSAAWHSILDGKLSALDEEFDVVATKWHDKFGKLK
Ligand information
>5m0i Chain H (length=8) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SVPPGVTR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5m0i Molecular architecture and dynamics of ASH1 mRNA recognition by its mRNA-transport complex.
Resolution2.41 Å
Binding residue
(original residue number in PDB)		H150 E198 L200 L211 A214 I218
Binding residue
(residue number reindexed from 1)		H148 E191 L193 L204 A207 I211
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0008289 lipid binding
GO:1990825 sequence-specific mRNA binding
Biological Process
GO:0007533 mating type switching
GO:0008298 intracellular mRNA localization
GO:0051028 mRNA transport
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005934 cellular bud tip

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5m0i, PDBe:5m0i, PDBj:5m0i
PDBsum5m0i
PubMed28092367
UniProtP36068|SHE2_YEAST SWI5-dependent HO expression protein 2 (Gene Name=SHE2)

[Back to BioLiP]