Structure of PDB 5la9 Chain B Binding Site BS02

Receptor Information
>5la9 Chain B (length=212) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPALKLALEYIVPAMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTD
GQLVKDIRGDKITWIEGKEPGCETIGLLMSSMDDLICHCNGKLGSYKING
RTKAMVACYPGNGTGYVRHCDNPNGDGRCVTCIYYLNKDWDAKVSGGILR
IFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDAD
ERAAAKVKYLTG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5la9 Structural basis for oxygen degradation domain selectivity of the HIF prolyl hydroxylases.
Resolution2.813 Å
Binding residue
(original residue number in PDB)		Q239 L240 V241 W258 D277 C281 N284 I292 N293 G294 R295 T296 Y310 R312 H313 C314 D315 P317 R322 R370 W389 F391
Binding residue
(residue number reindexed from 1)		Q52 L53 V54 W64 D83 C87 N90 I98 N99 G100 R101 T102 Y116 R118 H119 C120 D121 P123 R128 R176 W195 F197
Enzymatic activity
Enzyme Commision number 1.14.11.29: hypoxia-inducible factor-proline dioxygenase.
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0031418 L-ascorbic acid binding

View graph for
Molecular Function
External links
PDB RCSB:5la9, PDBe:5la9, PDBj:5la9
PDBsum5la9
PubMed27561929
UniProtQ9GZT9|EGLN1_HUMAN Egl nine homolog 1 (Gene Name=EGLN1)

[Back to BioLiP]