Structure of PDB 5l9v Chain B Binding Site BS02

Receptor Information
>5l9v Chain B (length=215) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PALKLALEYIVPAMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDG
QLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLICHCNGKLG
SYKINGRTKAMVACYPGNGTGYVRHVDNCNGDGRCVTCIYYLNKDWDAKV
SGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITV
WYFDADERAAAKVKY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5l9v Structural basis for oxygen degradation domain selectivity of the HIF prolyl hydroxylases.
Resolution1.829 Å
Binding residue
(original residue number in PDB)		Q239 L240 V241 S242 K244 R252 W258 D277 C281 N284 I292 N293 G294 R295 T296 K297 Y310 H313 D315 C317 R322 R370 F391 R396
Binding residue
(residue number reindexed from 1)		Q51 L52 V53 S54 K56 R64 W70 D89 C93 N96 I104 N105 G106 R107 T108 K109 Y122 H125 D127 C129 R134 R182 F203 R208
Enzymatic activity
Enzyme Commision number 1.14.11.29: hypoxia-inducible factor-proline dioxygenase.
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0031418 L-ascorbic acid binding

View graph for
Molecular Function
External links
PDB RCSB:5l9v, PDBe:5l9v, PDBj:5l9v
PDBsum5l9v
PubMed27561929
UniProtQ9GZT9|EGLN1_HUMAN Egl nine homolog 1 (Gene Name=EGLN1)

[Back to BioLiP]