Structure of PDB 5krb Chain B Binding Site BS02

Receptor Information

>5krb Chain B (length=74) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QRTCLICGDRATGLHYGIISCEGCKGFFKRSISNKRVYRCSRDKNCVMSR
KQRNRCQYCRLLKCLQMGMNRKAI

Ligand information

>5krb Chain E (length=16) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tctagccttgacctct

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5krb A Structural Investigation into Oct4 Regulation by Orphan Nuclear Receptors, Germ Cell Nuclear Factor (GCNF), and Liver Receptor Homolog-1 (LRH-1).
Resolution	2.101 Å
Binding residue (original residue number in PDB)	E93 G94 R101 R107 R121 R124 N125 Q128 R131
Binding residue (residue number reindexed from 1)	E22 G23 R30 R36 R50 R53 N54 Q57 R60
Binding affinity	PDBbind-CN: Kd=170nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0008270	zinc ion binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5krb, PDBe:5krb, PDBj:5krb
PDBsum	5krb
PubMed	27984042
UniProt	Q64249\|NR6A1_MOUSE Nuclear receptor subfamily 6 group A member 1 (Gene Name=Nr6a1)

[Back to BioLiP]