Structure of PDB 5k58 Chain B Binding Site BS02

Receptor Information

>5k58 Chain B (length=189) Species: 331111 (Escherichia coli O139:H28 str. E24377A)

NRREEILQSLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMF
DSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGERNPGLTRIL
TGHALMFEQDRLQGRINQLFERIEAQLRQVMREKRMREGEGYTTDETLLA
SQILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ

Ligand information

>5k58 Chain K (length=8) Species: 32630 (synthetic construct)

LDIPAFLR

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5k58 Structures of the nucleoid occlusion protein SlmA bound to DNA and the C-terminal domain of the cytoskeletal protein FtsZ.
• Resolution: 2.772 Å
• Binding residue (original residue number in PDB): L16 Q17 L62 F65 S69 R73 I77 L94 F98 N102
• Binding residue (residue number reindexed from 1): L7 Q8 L53 F56 S60 R64 I68 L85 F89 N93

Gene Ontology

Molecular Function

• GO:0000976 transcription cis-regulatory region binding
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0042803 protein homodimerization activity
• GO:0043565 sequence-specific DNA binding

Biological Process

• GO:0000918 division septum site selection
• GO:0006355 regulation of DNA-templated transcription
• GO:0010974 negative regulation of division septum assembly
• GO:0032272 negative regulation of protein polymerization
• GO:0051301 cell division
• GO:0051302 regulation of cell division

Cellular Component

• GO:0005737 cytoplasm
• GO:0009295 nucleoid
• GO:0043590 bacterial nucleoid

External links

• PDB: RCSB:5k58, PDBe:5k58, PDBj:5k58
• PDBsum: 5k58
• PubMed: 27091999
• UniProt: P0C093|SLMA_ECOLI Nucleoid occlusion factor SlmA (Gene Name=slmA)