Structure of PDB 5jme Chain B Binding Site BS02

Receptor Information

>5jme Chain B (length=209) Species: 6500 (Aplysia californica) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTN
EVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRP
VQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWV
YSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDV
NLVVKFRER

Ligand information

>5jme Chain I (length=16) Species: 330676 (Conus pergrandis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GCCSHPACSVNHPELC

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5jme Crystal structure of acetylcholine binding protein (AChBP) from Aplysia Californica in complex with alpha-conotoxin PeIA
Resolution	2.336 Å
Binding residue (original residue number in PDB)	Y55 Q57 R59 R79 V108 M116 I118 D164 S166 S167
Binding residue (residue number reindexed from 1)	Y57 Q59 R61 R81 V110 M118 I120 D166 S168 S169

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004888	transmembrane signaling receptor activity
GO:0005216	monoatomic ion channel activity
GO:0005230	extracellular ligand-gated monoatomic ion channel activity

	Biological Process
GO:0006811	monoatomic ion transport
GO:0034220	monoatomic ion transmembrane transport

	Cellular Component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5jme, PDBe:5jme, PDBj:5jme
PDBsum	5jme
PubMed
UniProt	Q8WSF8

[Back to BioLiP]